PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10016889
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRAS
Protein Properties Length: 511aa    MW: 56711.1 Da    PI: 4.8658
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10016889genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS26.76.4e-09149204156
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlars 56 
                  lve Ll++Ae v ++++  a +lL+    las++g+++qRl  y++eAL+ r++r+
  Lus10016889 149 LVEYLLAAAERVGDQQFDHAASLLNLCGSLASKSGNAVQRLGYYLAEALRDRISRE 204
                  5789*************************************************994 PP

2GRAS212.52.3e-6520649197374
         GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRp.......egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak.. 184
                  +a qaIle v +++++H+iD+ i+ G QW+aL+q L  sR+       ++   lRiT+vg  ++ ++ ++eetg+rLa+fA ++++pf+f+v+v++  
  Lus10016889 206 AAVQAILENVTSSNKIHVIDLKIGSGQQWVALMQGLLtSRSdedraggASVDLLRITAVGI-TALDRSQVEETGDRLASFAGSINIPFRFEVVVVTde 302
                  799*******************************9764888766653223569********.6679**************************954323 PP

         GRAS 185 .rledleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                   + +d++++++ ++p +E+++V +   l++l  ++  +e+    v+ ++k+++P+++vvve ea++ns++F +rf+e++ +y a+f+ le++++r++ 
  Lus10016889 303 kEASDFRPDRFGLEPeEESVVVYSEGVLKTLIGQPRRIEQ----VMLTLKRMNPRIMVVVEVEANLNSPNFGRRFVETMFHYGAIFENLESTMGRDNM 396
                  489999*********9999*************88888888....****************************************************** PP

         GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   r+ +E  llg +++n++a  g+er  r  + + Wr+ + ++G+ +v+ s  +  qak  l ++  ++ y+ve + +sl+lg k+ p+  vS W+
  Lus10016889 397 FRAGIESGLLGHQVSNILASDGEERHVRGVKIGVWRKFFARFGMVEVEPSAMTLHQAKWFLYRFVkNQSYTVEMDGKSLILGFKGIPVRCVSTWK 491
                  **************************************************************9998899*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035142.2E-6149204IPR005202Transcription factor GRAS
PfamPF035148.0E-63206491IPR005202Transcription factor GRAS
PROSITE profilePS5098530.233206470IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MNTSQNGWSP LSNLDNFDDQ WLHMFSPLCH LGSDEIEELG RILDEAGPDE GTSNPSDEPV  60
VEEPPPTSSQ QQLPSPPLSF DLLHTHGGKS NFSSGEKEGP TTVDQVLRIA GQRVVEFSNG  120
RAGAPSMLHL PMDPSLSHLS EEDVKNVELV EYLLAAAERV GDQQFDHAAS LLNLCGSLAS  180
KSGNAVQRLG YYLAEALRDR ISRETAAVQA ILENVTSSNK IHVIDLKIGS GQQWVALMQG  240
LLTSRSDEDR AGGASVDLLR ITAVGITALD RSQVEETGDR LASFAGSINI PFRFEVVVVT  300
DEKEASDFRP DRFGLEPEEE SVVVYSEGVL KTLIGQPRRI EQVMLTLKRM NPRIMVVVEV  360
EANLNSPNFG RRFVETMFHY GAIFENLEST MGRDNMFRAG IESGLLGHQV SNILASDGEE  420
RHVRGVKIGV WRKFFARFGM VEVEPSAMTL HQAKWFLYRF VKNQSYTVEM DGKSLILGFK  480
GIPVRCVSTW KFVRIGRLVR DNEELRVEFY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-2316849122375GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-41RGA-like 1